Structure of PDB 3qfq Chain B Binding Site BS01

Receptor Information
>3qfq Chain B (length=120) Species: 493803 (Merkel cell polyomavirus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPVPTDFPIDLSDYLSHAVYSNKTVSCFAIYTTSDKAIELYDKIEKFKVD
FKSRHACELGCILLFITLSKHRVSAIKNFCSTFCTISFLICKGVNKMPEM
YNNLCKPPYKLLQENKPLLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qfq Asymmetric assembly of merkel cell polyomavirus large T-antigen origin binding domains at the viral origin.
Resolution2.9001 Å
Binding residue
(original residue number in PDB)		T332 K378 H379 R380 A383
Binding residue
(residue number reindexed from 1)		T24 K70 H71 R72 A75
Binding affinityPDBbind-CN: Kd=741nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003688 DNA replication origin binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3qfq, PDBe:3qfq, PDBj:3qfq
PDBsum3qfq
PubMed21501625
UniProtE2IPT4

[Back to BioLiP]