Structure of PDB 3q8d Chain B Binding Site BS01

Receptor Information
>3q8d Chain B (length=232) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQ
PFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLE
YETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHC
AGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADT
LRAAKRFTRMALKPYLGGKPLKSRELFRQFMP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3q8d Mechanism of RecO recruitment to DNA by single-stranded DNA binding protein.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		E128 R132 K206 R210 R225
Binding residue
(residue number reindexed from 1)		E127 R131 K205 R209 R224
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0000725 recombinational repair
GO:0006281 DNA repair
GO:0006302 double-strand break repair
GO:0006310 DNA recombination
GO:0009411 response to UV
Cellular Component
GO:0043590 bacterial nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3q8d, PDBe:3q8d, PDBj:3q8d
PDBsum3q8d
PubMed21504984
UniProtP0A7H3|RECO_ECOLI DNA repair protein RecO (Gene Name=recO)

[Back to BioLiP]