Structure of PDB 3q49 Chain B Binding Site BS01

Receptor Information
>3q49 Chain B (length=132) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLK
MQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYS
LAKEQRLNFGDDIPSALRIAKKKRWNSIEERR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3q49 Molecular Mechanism of the Negative Regulation of Smad1/5 Protein by Carboxyl Terminus of Hsc70-interacting Protein (CHIP).
Resolution1.543 Å
Binding residue
(original residue number in PDB)
K31 N35 F38 Y50 N66 L69 K96 F99 F132 D135
Binding residue
(residue number reindexed from 1)
K8 N12 F15 Y27 N43 L46 K73 F76 F109 D112
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:3q49, PDBe:3q49, PDBj:3q49
PDBsum3q49
PubMed21454478
UniProtQ9WUD1|CHIP_MOUSE E3 ubiquitin-protein ligase CHIP (Gene Name=Stub1)

[Back to BioLiP]