Structure of PDB 3q33 Chain B Binding Site BS01

Receptor Information

>3q33 Chain B (length=213) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NEHAKAFLGLAKCEEEVDAIEREVELYRLNKMKPVYEKRDAYIDEIAEFW
KIVLSQHVSFANYIRASDFKYIDTIDKIKVEWLALESEMYDTRDFSITFH
FHGIEGDFKEQQVTKVFQIKKGDGILTSEPVPIEWPQSYDSINPDLIKDK
RSPEGKKKYRQGMKTIFGWFRWTGLKPGKEFPHGDSLASLFSEEIYPFCV
KYYAEAQRDLEDE

Ligand information

>3q33 Chain D (length=4) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TGGK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3q33 Structure of the Rtt109-AcCoA/Vps75 Complex and Implications for Chaperone-Mediated Histone Acetylation.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	N70 S199
Binding residue (residue number reindexed from 1)	N62 S186

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006334	nucleosome assembly

	Cellular Component
GO:0005634	nucleus

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3q33, PDBe:3q33, PDBj:3q33
PDBsum	3q33
PubMed	21256037
UniProt	P53853\|VPS75_YEAST Vacuolar protein sorting-associated protein 75 (Gene Name=VPS75)

[Back to BioLiP]