Structure of PDB 3pxe Chain B Binding Site BS01

Receptor Information
>3pxe Chain B (length=213) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFV
CERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNH
QGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELS
SFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTRKWVLDSVALYQ
CQELDTYLIPQIP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pxe Impact of BRCA1 BRCT Domain Missense Substitutions on Phosphopeptide Recognition.
Resolution2.85 Å
Binding residue
(original residue number in PDB)
S1655 R1699 T1700 K1702 V1741 N1774 M1775
Binding residue
(residue number reindexed from 1)
S9 R53 T54 K56 V95 N128 M129
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004842 ubiquitin-protein transferase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006281 DNA repair
GO:0006974 DNA damage response
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3pxe, PDBe:3pxe, PDBj:3pxe
PDBsum3pxe
PubMed21473589
UniProtP38398|BRCA1_HUMAN Breast cancer type 1 susceptibility protein (Gene Name=BRCA1)

[Back to BioLiP]