Structure of PDB 3psr Chain B Binding Site BS01

Receptor Information
>3psr Chain B (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKG
TNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS
Ligand information
Ligand IDZN
InChIInChI=1S/Zn/q+2
InChIKeyPTFCDOFLOPIGGS-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Zn++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Zn+2]
FormulaZn
NameZINC ION
ChEMBLCHEMBL1236970
DrugBankDB14532
ZINC
PDB chain3psr Chain A Residue 103 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3psr Zinc-binding site of an S100 protein revealed. Two crystal structures of Ca2+-bound human psoriasin (S100A7) in the Zn2+-loaded and Zn2+-free states.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		H86 H90
Binding residue
(residue number reindexed from 1)		H86 H90
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
GO:0046914 transition metal ion binding
GO:0048306 calcium-dependent protein binding
GO:0050786 RAGE receptor binding
GO:0140486 zinc ion sequestering activity
Biological Process
GO:0000302 response to reactive oxygen species
GO:0001525 angiogenesis
GO:0008544 epidermis development
GO:0010820 positive regulation of T cell chemotaxis
GO:0030216 keratinocyte differentiation
GO:0032496 response to lipopolysaccharide
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0071624 positive regulation of granulocyte chemotaxis
GO:0090026 positive regulation of monocyte chemotaxis
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005925 focal adhesion
GO:0035578 azurophil granule lumen
GO:0062023 collagen-containing extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3psr, PDBe:3psr, PDBj:3psr
PDBsum3psr
PubMed10026247
UniProtP31151|S10A7_HUMAN Protein S100-A7 (Gene Name=S100A7)

[Back to BioLiP]