Structure of PDB 3po1 Chain B Binding Site BS01

Receptor Information
>3po1 Chain B (length=147) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKET
Ligand information
>3po1 Chain A (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ADCGLRPLFEKKSLEDKTERELLESYI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3po1 Discovery of benzothiazole guanidines as novel inhibitors of thrombin and trypsin IV.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		E44 G46 M47 P49 W50 D149 H152 P153 C155 Y170 K171 R173
Binding residue
(residue number reindexed from 1)		E8 G10 M11 P13 W14 D113 H116 P117 C119 Y134 K135 R137
Enzymatic activity
Catalytic site (original residue number in PDB) H79 D135
Catalytic site (residue number reindexed from 1) H43 D99
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3po1, PDBe:3po1, PDBj:3po1
PDBsum3po1
PubMed22726924
UniProtP00734|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]