Structure of PDB 3pmp Chain B Binding Site BS01

Receptor Information
>3pmp Chain B (length=163) Species: 153609 (Moniliophthora perniciosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMANVFFNISINDKPEGRIVFKLYDEAVPKTAKNFRELATGQHGFGYKDS
IFHRVIPQFMLQGGDFTRHNGTGGKSIYGEKFADENFQVKHTKPGLLSMA
NAGANTNGSQFFITTVPTSWLDGKHVVFGEVIEGLDIVRKVEGKGSASGK
TNATIKITDCGTV
Ligand information
>3pmp Chain D (length=11) Species: 29910 (Tolypocladium inflatum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ALLVTPGLVLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pmp Crystal Structure of Cyclophilin A from Moniliophthora perniciosa
Resolution1.47 Å
Binding residue
(original residue number in PDB)		R53 F58 Q61 G70 A99 N100 A101 Q109 F111 W119 H124
Binding residue
(residue number reindexed from 1)		R54 F59 Q62 G71 A100 N101 A102 Q110 F112 W120 H125
Enzymatic activity
Catalytic site (original residue number in PDB) R53 F58 Q61 N100 F111 L120 H124
Catalytic site (residue number reindexed from 1) R54 F59 Q62 N101 F112 L121 H125
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
Biological Process
GO:0000413 protein peptidyl-prolyl isomerization
GO:0006457 protein folding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3pmp, PDBe:3pmp, PDBj:3pmp
PDBsum3pmp
PubMed
UniProtE3P6K5

[Back to BioLiP]