Structure of PDB 3pl7 Chain B Binding Site BS01

Receptor Information
>3pl7 Chain B (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNRELVVDFLSYKLSQKGYSWSQFSDESEAVKQALREAGDEFELRYRRAF
SDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESV
DKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYG
Ligand information
>3pl7 Chain C (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ASTKKLSECLKRIGDELDSNMELQRM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pl7 Mutation to Bax beyond the BH3 domain disrupts interactions with pro-survival proteins and promotes apoptosis
Resolution2.613 Å
Binding residue
(original residue number in PDB)		Y101 R103 L108 L130 N136 G138 R139 L194 Y195
Binding residue
(residue number reindexed from 1)		Y46 R48 L53 L75 N81 G83 R84 L139 Y140
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:3pl7, PDBe:3pl7, PDBj:3pl7
PDBsum3pl7
PubMed21199865
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]