Structure of PDB 3p49 Chain B Binding Site BS01

Receptor Information
>3p49 Chain B (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Ligand information
>3p49 Chain A (length=169) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggauaugaggagagauuucauccauugcacuccggaugaaacaccgaaga
aguaaaucuuucagguaaaaaggacucauauuggacgaaccucuggagag
cuuaucuaagagauaacaccgaaggagcaaagcuaauuuuagccuaaacu
cucagguaaaaggacggag
.<<<<<<<<......<<<<<<<<..........>>>>>>>>.<<<...<<
<<.....>>>.>.>>>........>>>>>>>>........<<<<<.....
.<<<<<.....>>>>>.<<<...<<<<....<<<<....>>>>.....>>
>>..>>>.......>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3p49 Structural basis of cooperative ligand binding by the glycine riboswitch.
Resolution3.55 Å
Binding residue
(original residue number in PDB)		Y13 N16 E19 S48 L49 K50 R52 Q54 F56 R83 Q85 Y86 T89 S91
Binding residue
(residue number reindexed from 1)		Y8 N11 E14 S43 L44 K45 R47 Q49 F51 R78 Q80 Y81 T84 S86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3p49, PDBe:3p49, PDBj:3p49
PDBsum3p49
PubMed21439473
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]