Structure of PDB 3oyp Chain B Binding Site BS01

Receptor Information
>3oyp Chain B (length=175) Species: 11116 (Hepatitis C virus (isolate Japanese)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNG
VCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCG
SSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHV
VGIFRAAVCTRGVAKAVDFIPVESM
Ligand information
>3oyp Chain D (length=12) Species: 11116 (Hepatitis C virus (isolate Japanese)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSVVIVGRIILS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3oyp Selective irreversible inhibition of a protease by targeting a noncatalytic cysteine.
Resolution2.76 Å
Binding residue
(original residue number in PDB)		T4 A5 Y6 S7 Q8 T10 R11 T19 S20 D30 E32 V33 Q34 V35 L36 S37 K62 T63 L64 A65
Binding residue
(residue number reindexed from 1)		T4 A5 Y6 S7 Q8 T10 R11 T19 S20 D30 E32 V33 Q34 V35 L36 S37 K62 T63 L64 A65
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D81 G137 S139
Catalytic site (residue number reindexed from 1) H57 D81 G137 S139
Enzyme Commision number 2.7.7.48: RNA-directed RNA polymerase.
3.4.21.98: hepacivirin.
3.4.22.-
3.6.1.15: nucleoside-triphosphate phosphatase.
3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0019087 transformation of host cell by virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3oyp, PDBe:3oyp, PDBj:3oyp
PDBsum3oyp
PubMed21113170
UniProtP26662|POLG_HCVJA Genome polyprotein

[Back to BioLiP]