Structure of PDB 3owt Chain B Binding Site BS01

Receptor Information
>3owt Chain B (length=148) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVIS
GDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKD
NVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFE
Ligand information
>3owt Chain C (length=20) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KMIDFATLSKLKKKYQIILD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3owt A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		P730 Q732 A733 G760
Binding residue
(residue number reindexed from 1)		P55 Q57 A58 G85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000723 telomere maintenance

View graph for
Biological Process
External links
PDB RCSB:3owt, PDBe:3owt, PDBj:3owt
PDBsum3owt
PubMed21217703
UniProtP11938|RAP1_YEAST DNA-binding protein RAP1 (Gene Name=RAP1)

[Back to BioLiP]