Structure of PDB 3ovb Chain B Binding Site BS01

Receptor Information
>3ovb Chain B (length=437) Species: 2234 (Archaeoglobus fulgidus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYAR
NTWLKGSLEIDVFLLFPEEFSKEELRERGLEIGKAVLDSYEIRYAEHPYV
HGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRL
LKGFLKANGIYGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTV
IDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHLCREFMEAPS
LGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERA
SRKIFEFLERENFMPLRSAFKASEEFCYLLFECQIKEISRVFRRMGPQFE
DERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
Ligand information
>3ovb Chain D (length=35) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggaaguagaugguucaaguccauuuacuuccacca
<<<<<<<<<<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ovb How the CCA-Adding Enzyme Selects Adenine over Cytosine at Position 76 of tRNA.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		R50 D61 F63 A95 E96 H97 Y99 D110 V127 T130 H133 A163 E164 Y165 R224 A228 N229 D291 N292 P295 Q296 R299 K303 R310 G346 P347 N354 K357 F358 R361 R363 Y392 H396 H398 T399 G401 K402
Binding residue
(residue number reindexed from 1)		R50 D61 F63 A95 E96 H97 Y99 D110 V127 T130 H133 A163 E164 Y165 R224 A228 N229 D291 N292 P295 Q296 R299 K303 R310 G346 P347 N354 K357 F358 R361 R363 Y392 H396 H398 T399 G401 K402
Enzymatic activity
Enzyme Commision number 2.7.7.72: CCA tRNA nucleotidyltransferase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0000287 magnesium ion binding
GO:0003723 RNA binding
GO:0004810 CCA tRNA nucleotidyltransferase activity
GO:0005524 ATP binding
GO:0016779 nucleotidyltransferase activity
GO:0046872 metal ion binding
GO:0160016 CCACCA tRNA nucleotidyltransferase activity
Biological Process
GO:0001680 tRNA 3'-terminal CCA addition
GO:0008033 tRNA processing
GO:0031123 RNA 3'-end processing
GO:0042245 RNA repair
GO:0106354 tRNA surveillance

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3ovb, PDBe:3ovb, PDBj:3ovb
PDBsum3ovb
PubMed21071662
UniProtO28126|CCA_ARCFU CCA-adding enzyme (Gene Name=cca)

[Back to BioLiP]