Structure of PDB 3oud Chain B Binding Site BS01

Receptor Information
>3oud Chain B (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PQITLWQRPIVTIKIGGQLKEALLNTGADDTTLEEVNLPGRWKPKLIGGI
GGFVKVRQYDQVPIEICGHKVIGTVLVGPTPTNVIGRNLMTQIGCTLNF
Ligand information
>3oud Chain P (length=7) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RVLFEAM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3oud Nine Crystal Structures Determine the Substrate Envelope of the MDR HIV-1 Protease.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		R8 N25 G27 A28 D29 D30 K45 L46 G48 P81 T82
Binding residue
(residue number reindexed from 1)		R8 N25 G27 A28 D29 D30 K45 L46 G48 P81 T82
Enzymatic activity
Catalytic site (original residue number in PDB) N25 T26 G27
Catalytic site (residue number reindexed from 1) N25 T26 G27
Enzyme Commision number 2.7.7.-
2.7.7.49: RNA-directed DNA polymerase.
2.7.7.7: DNA-directed DNA polymerase.
3.1.-.-
3.1.13.2: exoribonuclease H.
3.1.26.13: retroviral ribonuclease H.
3.4.23.16: HIV-1 retropepsin.
Gene Ontology
Molecular Function
GO:0004190 aspartic-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3oud, PDBe:3oud, PDBj:3oud
PDBsum3oud
PubMed21394574
UniProtP35963|POL_HV1Y2 Gag-Pol polyprotein (Gene Name=gag-pol)

[Back to BioLiP]