Structure of PDB 3omo Chain B Binding Site BS01

Receptor Information

>3omo Chain B (length=224) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWA
KKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDLVLD
RDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPL
VTAKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNK
GMEHLLNMKCKNVVPVYDLLLEML

Ligand information

>3omo Chain D (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RHKILHRLLQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3omo Design and Evaluation of Fragment-Like Estrogen Receptor Tetrahydroisoquinoline Ligands from a Scaffold-Detection Approach.
Resolution	2.21 Å
Binding residue (original residue number in PDB)	K314 L324 V328 E332 E493
Binding residue (residue number reindexed from 1)	K51 L61 V65 E69 E222

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3omo, PDBe:3omo, PDBj:3omo
PDBsum	3omo
PubMed	21381753
UniProt	Q92731\|ESR2_HUMAN Estrogen receptor beta (Gene Name=ESR2)

[Back to BioLiP]