Structure of PDB 3ob1 Chain B Binding Site BS01

Receptor Information
>3ob1 Chain B (length=296) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEG
KMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKL
SLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKS
FRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSL
LRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWA
IGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ob1 Additional serine/threonine phosphorylation reduces binding affinity but preserves interface topography of substrate proteins to the c-Cbl TKB domain
Resolution2.2 Å
Binding residue
(original residue number in PDB)		N79 S80 P81 D86 Y274 R294 C297 T298 Y307 Q316 T317 I318 F336 Y337
Binding residue
(residue number reindexed from 1)		N25 S26 P27 D32 Y220 R240 C243 T244 Y253 Q262 T263 I264 F282 Y283
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0001784 phosphotyrosine residue binding
GO:0004842 ubiquitin-protein transferase activity
GO:0005509 calcium ion binding
Biological Process
GO:0007166 cell surface receptor signaling pathway
GO:0023051 regulation of signaling

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3ob1, PDBe:3ob1, PDBj:3ob1
PDBsum3ob1
PubMed20877636
UniProtP22681|CBL_HUMAN E3 ubiquitin-protein ligase CBL (Gene Name=CBL)

[Back to BioLiP]