Structure of PDB 3o9x Chain B Binding Site BS01

Receptor Information
>3o9x Chain B (length=132) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEE
SDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAF
SRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3o9x Structure of the Escherichia coli Antitoxin MqsA (YgiT/b3021) Bound to Its Gene Promoter Reveals Extensive Domain Rearrangements and the Specificity of Transcriptional Regulation.
Resolution2.0999 Å
Binding residue
(original residue number in PDB)		Q85 N97 S100 H110
Binding residue
(residue number reindexed from 1)		Q86 N98 S101 H111
Binding affinityPDBbind-CN: Kd=0.8nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0043565 sequence-specific DNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0044010 single-species biofilm formation
Cellular Component
GO:0110001 toxin-antitoxin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3o9x, PDBe:3o9x, PDBj:3o9x
PDBsum3o9x
PubMed21068382
UniProtQ46864|MQSA_ECOLI Antitoxin MqsA (Gene Name=mqsA)

[Back to BioLiP]