Structure of PDB 3o45 Chain B Binding Site BS01

Receptor Information
>3o45 Chain B (length=217) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVLTQSPASLAVSLGQRATIFCRASQSVDYNGISYMHWFQQKPGQPPKL
LIYAASNPESGIPARFTGSGSGTDFTLNIHPVEEEDAATYYCQQIIEDPW
TFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINV
KWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEA
THKTSTSPIVKSFNRNE
Ligand information
>3o45 Chain C (length=10) Species: 11259 (Human respiratory syncytial virus A2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NRGIIKTFSN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3o45 Structure of a Major Antigenic Site on the Respiratory Syncytial Virus Fusion Glycoprotein in Complex with Neutralizing Antibody 101F.
Resolution2.872 Å
Binding residue
(original residue number in PDB)		Y32 I91 I92 D94
Binding residue
(residue number reindexed from 1)		Y36 I95 I96 D98
External links