Structure of PDB 3nvi Chain B Binding Site BS01

Receptor Information
>3nvi Chain B (length=121) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVI
IAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAII
EPGKARDLVEEIAMKVKELMK
Ligand information
>3nvi Chain E (length=24) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cucugaccgaaaggcgugaugagc
..<...<<....>>......>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3nvi Structural basis for substrate placement by an archaeal box C/D ribonucleoprotein particle.
Resolution2.709 Å
Binding residue
(original residue number in PDB)		K35 G36 T37 N38 E39 K42 R46 V58 D59 I63 K84 V95 A96 A97 A98
Binding residue
(residue number reindexed from 1)		K32 G33 T34 N35 E36 K39 R43 V55 D56 I60 K81 V92 A93 A94 A95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006364 rRNA processing
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3nvi, PDBe:3nvi, PDBj:3nvi
PDBsum3nvi
PubMed20864039
UniProtQ8U160|RL7A_PYRFU Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]