Structure of PDB 3nim Chain B Binding Site BS01

Receptor Information
>3nim Chain B (length=82) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSVHKHTGRNCGRKFKIGEPLYRCHECGCDDTCVLCIHCFNPKDHVNHHV
CTDICTEFTSGICDCGDEEAWNSPLHCKAEEQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3nim Structural basis for the recognition of N-end rule substrates by the UBR box of ubiquitin ligases
Resolution2.0 Å
Binding residue
(original residue number in PDB)		K155 Q194
Binding residue
(residue number reindexed from 1)		K43 Q82
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0071596 ubiquitin-dependent protein catabolic process via the N-end rule pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3nim, PDBe:3nim, PDBj:3nim
PDBsum3nim
PubMed20835240
UniProtP19812|UBR1_YEAST E3 ubiquitin-protein ligase UBR1 (Gene Name=UBR1)

[Back to BioLiP]