Structure of PDB 3n9z Chain B Binding Site BS01

Receptor Information
>3n9z Chain B (length=470) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLG
NVESVYVIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKS
AAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNY
SGDISDDLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTS
VPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSV
HHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMAR
NLKVQDMLRAEVLAARHQAQGDMATMLQLVPLLKASIKETLRLHPISVTL
QRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSKD
KNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVG
TTFNLILMPEKPISFTFWPF
Ligand information
>3n9z Chain D (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GACEGTLACSTCHLDEENDMLDLRLGC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3n9z Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.
Resolution2.17 Å
Binding residue
(original residue number in PDB)		K109 N116 M120 A121 K339 K343 F411 W418 G419 V420 Q422
Binding residue
(residue number reindexed from 1)		K104 N111 M115 A116 K334 K338 F406 W413 G414 V415 Q417
Enzymatic activity
Catalytic site (original residue number in PDB) T291 F416 C423
Catalytic site (residue number reindexed from 1) T286 F411 C418
Enzyme Commision number 1.14.15.6: cholesterol monooxygenase (side-chain-cleaving).
Gene Ontology
Molecular Function
GO:0004497 monooxygenase activity
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0008386 cholesterol monooxygenase (side-chain-cleaving) activity
GO:0008395 steroid hydroxylase activity
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0006694 steroid biosynthetic process
GO:0006700 C21-steroid hormone biosynthetic process
GO:0006704 glucocorticoid biosynthetic process
GO:0008203 cholesterol metabolic process
GO:0008207 C21-steroid hormone metabolic process
GO:0016125 sterol metabolic process
GO:0034650 cortisol metabolic process
GO:0042359 vitamin D metabolic process
GO:0042446 hormone biosynthetic process
GO:0071375 cellular response to peptide hormone stimulus
GO:1901615 organic hydroxy compound metabolic process
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005759 mitochondrial matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3n9z, PDBe:3n9z, PDBj:3n9z
PDBsum3n9z
PubMed21636783
UniProtP05108|CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial (Gene Name=CYP11A1)

[Back to BioLiP]