Structure of PDB 3n84 Chain B Binding Site BS01

Receptor Information
>3n84 Chain B (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGN
DVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQ
VPQQPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3n84 Thermodynamic and Structural Effects of Macrocyclization as a Constraining Method in Protein-Ligand Interactions.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
R67 R86 S88 S90 S96 Q106 H107 F108 K109 L120 W121
Binding residue
(residue number reindexed from 1)
R14 R33 S35 S37 S43 Q53 H54 F55 K56 L67 W68
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3n84, PDBe:3n84, PDBj:3n84
PDBsum3n84
PubMed21116482
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]