Structure of PDB 3mzh Chain B Binding Site BS01

Receptor Information
>3mzh Chain B (length=225) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYI
IISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEV
RAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGR
VAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFA
HRGWIRLEGKSVLISDSERLARRAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mzh Crystal Structure of Camp Receptor Protein from Mycobacterium Tuberculosis in Complex with DNA and cAMP
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R65 D145 V146 S187 T190
Binding residue
(residue number reindexed from 1)		R66 D146 V147 S188 T191
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0030552 cAMP binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3mzh, PDBe:3mzh, PDBj:3mzh
PDBsum3mzh
PubMed
UniProtP9WMH3|CRPL_MYCTU CRP-like cAMP-activated global transcriptional regulator (Gene Name=crp)

[Back to BioLiP]