Structure of PDB 3mxb Chain B Binding Site BS01

Receptor Information

>3mxb Chain B (length=153) Species: 3055 (Chlamydomonas reinhardtii)

NTKYNEEFLLYLAGFVDSDGSIIAQIKPRQSNKFKHQLSLTFAVTQKTQR
RWFLDKLVDEIGVGYVYDSGSVSDYRLSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LDS

Ligand information

>3mxb Chain C (length=24)

ttgttctcaggtacctcagccaga

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3mxb Molecular basis of engineered meganuclease targeting of the endogenous human RAG1 locus.
• Resolution: 2.3 Å
• Binding residue (original residue number in PDB): R30 S32 N33 K34 Q38 Y66 Y68 E80 I81 K116 K139
• Binding residue (residue number reindexed from 1): R29 S31 N32 K33 Q37 Y65 Y67 E79 I80 K115 K138
• Binding affinity: PDBbind-CN: Kd=28nM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Mar 11 13:00:09 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3mxb', asym_id = 'B', bs = 'BS01', title = 'Molecular basis of engineered meganuclease targeting of the endogenous human RAG1 locus.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3mxb', asym_id='B', bs='BS01', title='Molecular basis of engineered meganuclease targeting of the endogenous human RAG1 locus.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0004519', uniprot = '', pdbid = '3mxb', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519', uniprot='', pdbid='3mxb', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>