Structure of PDB 3moj Chain B Binding Site BS01

Receptor Information
>3moj Chain B (length=75) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKLYFNGGKKKKIRAVDFVGTIAKIDGVSADDIGIITIMDNASYVEILNG
KGPHVLKVMKNTTVKGKQLKVNKAN
Ligand information
>3moj Chain A (length=69) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcucaucacauccuggggcuggaaacggucccaaggguauggcuguucg
ccauuuaaagugguagcua
<<<<..<<<<<<<<<<<<<<<<....>>>>>>>.>>>>><<<<<.....>
>>>>.....>>>>.>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3moj Structure of the RNA binding domain of a DEAD-box helicase bound to its ribosomal RNA target reveals a novel mode of recognition by an RNA recognition motif.
Resolution2.902 Å
Binding residue
(original residue number in PDB)		K413 R417 D420 V422 G423 T424 A426 K427 A433 I436 G437 I439 T466 V467 K468 G469 K470 K473
Binding residue
(residue number reindexed from 1)		K10 R14 D17 V19 G20 T21 A23 K24 A30 I33 G34 I36 T63 V64 K65 G66 K67 K70
Binding affinityPDBbind-CN: Kd=54pM
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
External links
PDB RCSB:3moj, PDBe:3moj, PDBj:3moj
PDBsum3moj
PubMed20673833
UniProtP42305|DBPA_BACSU ATP-dependent RNA helicase DbpA (Gene Name=dbpA)

[Back to BioLiP]