Structure of PDB 3mnw Chain B Binding Site BS01

Receptor Information
>3mnw Chain B (length=204) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQLVQSGPELKKPGETVKISCKASGYTFTDYSVHWVKQVKGLKWMGWIN
TETGEPTYADDFKGRFAFSLESSASTAYLEIHNLKNEDTATYFCALGWLH
WGLGTTLTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGAL
TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK
RVEP
Ligand information
>3mnw Chain P (length=19) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QEKNEQELLELDKWASLWN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mnw Crystal Structure of a Non-Neutralizing HIV-1 gp41 Envelope Antibody Demonstrates Neutralization Mechanism of gp41 Antibodies
Resolution2.2 Å
Binding residue
(original residue number in PDB)
D31 Y32 S33 N52 T52A E53 W96 L101
Binding residue
(residue number reindexed from 1)
D31 Y32 S33 N50 T51 E52 W98 L99
Enzymatic activity
Enzyme Commision number ?
External links