Structure of PDB 3mky Chain B Binding Site BS01

Receptor Information
>3mky Chain B (length=115) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTSAYERGQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSV
VALFSHPGELSARSGDALQKAFTDKEELLKQQASNLHEQKKAGVIFEADE
VITLLTSVLKTSSAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mky Insight into F plasmid DNA segregation revealed by structures of SopB and SopB-DNA complexes.
Resolution2.86 Å
Binding residue
(original residue number in PDB)		N178 I179 S180 R190 K191 K226
Binding residue
(residue number reindexed from 1)		N22 I23 S24 R34 K35 K70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3mky, PDBe:3mky, PDBj:3mky
PDBsum3mky
PubMed20236989
UniProtP62558|SOPB_ECOLI Protein SopB (Gene Name=sopB)

[Back to BioLiP]