Structure of PDB 3mkw Chain B Binding Site BS01

Receptor Information
>3mkw Chain B (length=115) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTSAYERGQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSV
VALFSHPGELSARSGDALQKAFTDKEELLKQQASNLHEQKKAGVIFEADE
VITLLTSVLKTSSAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mkw Insight into F plasmid DNA segregation revealed by structures of SopB and SopB-DNA complexes.
Resolution2.99 Å
Binding residue
(original residue number in PDB)		I179 S180 R190 K191
Binding residue
(residue number reindexed from 1)		I23 S24 R34 K35
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3mkw, PDBe:3mkw, PDBj:3mkw
PDBsum3mkw
PubMed20236989
UniProtP62558|SOPB_ECOLI Protein SopB (Gene Name=sopB)

[Back to BioLiP]