Structure of PDB 3met Chain B Binding Site BS01

Receptor Information
>3met Chain B (length=174) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVK
AVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWK
ANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDT
SYADGYSPPLNVAQRYVVACKEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3met Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		D194 D196 T241 T242 C243 Y245
Binding residue
(residue number reindexed from 1)		D77 D79 T124 T125 C126 Y128
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:3met, PDBe:3met, PDBj:3met
PDBsum3met
PubMed21685874
UniProtQ96ES7|SGF29_HUMAN SAGA-associated factor 29 (Gene Name=SGF29)

[Back to BioLiP]