Structure of PDB 3me9 Chain B Binding Site BS01

Receptor Information
>3me9 Chain B (length=176) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAAR
VKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQ
WKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFE
DTSYADGYSPPLNVAQRYVVACKEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3me9 Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
Resolution1.37 Å
Binding residue
(original residue number in PDB)
R116 M120 D194 D196 Y238 T241 T242 C243 Y245 E265 D266
Binding residue
(residue number reindexed from 1)
R1 M5 D79 D81 Y123 T126 T127 C128 Y130 E150 D151
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:3me9, PDBe:3me9, PDBj:3me9
PDBsum3me9
PubMed21685874
UniProtQ96ES7|SGF29_HUMAN SAGA-associated factor 29 (Gene Name=SGF29)

[Back to BioLiP]