Structure of PDB 3mbe Chain B Binding Site BS01

Receptor Information
>3mbe Chain B (length=178) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RHFVHQFKGECYFTNGTQRIRLVTRYIYNREEYLRFDSDVGEYRAVTELG
RHSAEYYNKQYLERTRAELDTACRHNYEETEVPTSLRRLEQPNVAISLSR
HNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVML
EMTPHQGEVYTCHVEHPSLKSPITVEWS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mbe The diabetogenic mouse MHC class II molecule I-Ag7 is endowed with a switch that modulates TCR affinity.
Resolution2.886 Å
Binding residue
(original residue number in PDB)		F11 G13 Y60 Y61 Y66 R70 E74 T77 H81 N82 E85 T86 E87
Binding residue
(residue number reindexed from 1)		F7 G9 Y56 Y57 Y61 R64 E68 T71 H75 N76 E79 T80 E81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3mbe, PDBe:3mbe, PDBj:3mbe
PDBsum3mbe
PubMed20407212
UniProtQ31135

[Back to BioLiP]