Structure of PDB 3lu9 Chain B Binding Site BS01

Receptor Information
>3lu9 Chain B (length=251) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETKGQ
PSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDAG
GPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQ
F
Ligand information
>3lu9 Chain C (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ATNATLDPRSFLLRNPNDKYEPFWE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lu9 Crystal structure of thrombin bound to the uncleaved extracellular fragment of PAR1.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
F34 Q38 E39 L40 L41 C42 H57 Y60A W60D R67 R73 T74 R75 Y76 I82 E97A N143 K149E Q151 R173 I174 D189 A190 C191 E192 G193 A195 S214 W215 G216 E217 G219
Binding residue
(residue number reindexed from 1)
F19 Q24 E25 L26 L27 C28 H43 Y47 W50 R62 R68 T69 R70 Y71 I78 E94 N143 K148 Q150 R172 I173 D193 A194 C195 E196 G197 A199 S220 W221 G222 E223 G224
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 E192 G193 D194 A195 G196
Catalytic site (residue number reindexed from 1) H43 D99 E196 G197 D198 A199 G200
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3lu9, PDBe:3lu9, PDBj:3lu9
PDBsum3lu9
PubMed20236938
UniProtP00734|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]