Structure of PDB 3liy Chain B Binding Site BS01

Receptor Information
>3liy Chain B (length=116) Species: 11908 (Human T-cell leukemia virus type I) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVIPLDPARRPVIKAQVDTQTSHPKTIEALLDTGADMTVIPIALFSSNTP
LKNTSVLGAGGQTQDHFKLTSLPVLIRLPFRTTPIVLTSCLVDTKNNWAI
IGRDALQQCQGVLYLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3liy Crystal structures of inhibitor complexes of human T-cell leukemia virus (HTLV-1) protease.
Resolution1.86 Å
Binding residue
(original residue number in PDB)
R10 D32 G34 A35 D36 S55 L57 G58 W98
Binding residue
(residue number reindexed from 1)
R10 D32 G34 A35 D36 S55 L57 G58 W98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004190 aspartic-type endopeptidase activity
GO:0008233 peptidase activity
GO:0046872 metal ion binding
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3liy, PDBe:3liy, PDBj:3liy
PDBsum3liy
PubMed20600105
UniProtQ82134

[Back to BioLiP]