Structure of PDB 3l9y Chain B Binding Site BS01

Receptor Information

>3l9y Chain B (length=154) Species: 7091 (Bombyx mori)

MPAKAVCVLRGDVSGTVFFDQQDEKSPVVVSGEVQGLTKGKHGFHVHEFG
DNTNGCTSAGAHFNPEKQDHGGPSSAVRHVGDLGNIEAIEDAGVTKVSIQ
DSQISLHGPNSIIGRTLVVHADPDDLGLGGNELSKTTGNAGGRIACGVIG
LAKI

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 3l9y Chain B Residue 155

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3l9y Crystal structures of holo and Cu-deficient Cu/Zn-SOD from the silkworm Bombyx mori and the implications in amyotrophic lateral sclerosis.
• Resolution: 1.8 Å
• Binding residue (original residue number in PDB): H62 H70 H79 D82
• Binding residue (residue number reindexed from 1): H62 H70 H79 D82
• Annotation score: 1

Enzymatic activity

• Catalytic site (original residue number in PDB): H45 H47 H62 H70 H79 D82 H120 R143
• Catalytic site (residue number reindexed from 1): H45 H47 H62 H70 H79 D82 H120 R143
• Enzyme Commision number: 1.15.1.1: superoxide dismutase.

Gene Ontology

Molecular Function

• GO:0004784 superoxide dismutase activity
• GO:0005507 copper ion binding
• GO:0008270 zinc ion binding
• GO:0016209 antioxidant activity
• GO:0016491 oxidoreductase activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006801 superoxide metabolic process
• GO:0019430 removal of superoxide radicals
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3l9y, PDBe:3l9y, PDBj:3l9y
• PDBsum: 3l9y
• PubMed: 20310068
• UniProt: P82205|SODC_BOMMO Superoxide dismutase [Cu-Zn]