Structure of PDB 3l1p Chain B Binding Site BS01

Receptor Information
>3l1p Chain B (length=145) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTISRFEA
LQLSLKNMSKLRPLLEKWVEEADNNENLQEISKSQARKRKRTSIENRVRW
SLETMFLKSPKPSLQQITHIANQLGLEKDVVRVWFSNRRQKGKRS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3l1p A unique Oct4 interface is crucial for reprogramming to pluripotency
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R20 T26 Q27 Q44 S48 R49 R97 T98 V139 W140 N143
Binding residue
(residue number reindexed from 1)		R18 T24 Q25 Q42 S46 R47 R91 T92 V133 W134 N137
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3l1p, PDBe:3l1p, PDBj:3l1p
PDBsum3l1p
PubMed23376973
UniProtP20263|PO5F1_MOUSE POU domain, class 5, transcription factor 1 (Gene Name=Pou5f1)

[Back to BioLiP]