Structure of PDB 3kze Chain B Binding Site BS01

Receptor Information
>3kze Chain B (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMGKVTHSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKK
GLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPEL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kze The Tiam1 PDZ domain couples to Syndecan1 and promotes cell-matrix adhesion.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		T857 Y858 F860 S861 L862 S863 S864 E866 N876 S908 L911 L915
Binding residue
(residue number reindexed from 1)		T20 Y21 F23 S24 L25 S26 S27 E29 N39 S71 L74 L78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005085 guanyl-nucleotide exchange factor activity
Biological Process
GO:0007264 small GTPase-mediated signal transduction
GO:0090630 activation of GTPase activity

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3kze, PDBe:3kze, PDBj:3kze
PDBsum3kze
PubMed20361982
UniProtQ13009|TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 (Gene Name=TIAM1)

[Back to BioLiP]