Structure of PDB 3kut Chain B Binding Site BS01

Receptor Information
>3kut Chain B (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELL
HMLESPESLRSKVDEAVAVLQAHQAKEAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kut Molecular Determinants of PAM2 Recognition by the MLLE Domain of Poly(A)-Binding Protein.
Resolution1.5 Å
Binding residue
(original residue number in PDB)
Q560 G563 E564 F567 G579 K580 T582 G583 M584 E587 E592 K606 A610 V613 H617
Binding residue
(residue number reindexed from 1)
Q16 G19 E20 F23 G35 K36 T38 G39 M40 E43 E48 K62 A66 V69 H73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3kut, PDBe:3kut, PDBj:3kut
PDBsum3kut
PubMed20096703
UniProtP11940|PABP1_HUMAN Polyadenylate-binding protein 1 (Gene Name=PABPC1)

[Back to BioLiP]