Structure of PDB 3kus Chain B Binding Site BS01

Receptor Information
>3kus Chain B (length=70) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPES
LRSKVDEAVAVLQAHQAKEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kus Molecular Determinants of PAM2 Recognition by the MLLE Domain of Poly(A)-Binding Protein.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		Q560 G563 E564 F567 G579 K580 T582 G583 M584 E587 A610 H617
Binding residue
(residue number reindexed from 1)		Q8 G11 E12 F15 G27 K28 T30 G31 M32 E35 A58 H65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3kus, PDBe:3kus, PDBj:3kus
PDBsum3kus
PubMed20096703
UniProtP11940|PABP1_HUMAN Polyadenylate-binding protein 1 (Gene Name=PABPC1)

[Back to BioLiP]