Structure of PDB 3ktw Chain B Binding Site BS01

Receptor Information
>3ktw Chain B (length=93) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLRDLKEENRIVIWPSYFFSPTRSKGRRLARIPYKIKTEELVSTLRELGL
DPIVIENKKYPRDRKINFLIAVKKVKSKNYTLKIIHNALMGTR
Ligand information
>3ktw Chain D (length=95) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agauagucguggguucccuuucuggagggagagggaauuccacguugacc
gggggaaccggccaggcccggaagggagcaaccgugcccggcuau
..<<<<.<<<<<<<<<<<<<<<<....>>>>>>>>>>>.>>>>>....<.
<<<.....<<<...<.<<<....>>>..>..>>>..>>>.>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ktw Structural insights into the assembly of the human and archaeal signal recognition particles.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		S2 R4 K7 R11 V13 W15 Y18 T23 R24 S25 K26 R28 R29 A31 R32 K59 K60 Y61 P62 R63 R65 K75 S78 K79
Binding residue
(residue number reindexed from 1)		S1 R3 K6 R10 V12 W14 Y17 T22 R23 S24 K25 R27 R28 A30 R31 K58 K59 Y60 P61 R62 R64 K74 S77 K78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0008312 7S RNA binding
Biological Process
GO:0006612 protein targeting to membrane
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0005737 cytoplasm
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ktw, PDBe:3ktw, PDBj:3ktw
PDBsum3ktw
PubMed20179341
UniProtQ980W2|SRP19_SACS2 Signal recognition particle 19 kDa protein (Gene Name=srp19)

[Back to BioLiP]