Structure of PDB 3ktv Chain B Binding Site BS01

Receptor Information
>3ktv Chain B (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLN
VFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAA
EMIPKL
Ligand information
>3ktv Chain A (length=108) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcggcaucaauauggugaccucccgggagcgggggaccaccagguugccu
aaggaggggugaaccggcccaggucggaaacggagcaggucaaaacuccc
gugcugua
.<<<<<<<<<<.<<<<<..<<<<<<....>>>>>>..>>>>>.>>>>...
.....<<<<<......<<<....<<<....>>>....>>>....>>>>>.
>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ktv Structural insights into the assembly of the human and archaeal signal recognition particles.
Resolution3.8 Å
Binding residue
(original residue number in PDB)
D13 R14 F15 I16 C17 Y19 Y22 T28 I29 R33 R34 P36 I37 K66 M67 Y68 S69 R70 R74 R81 R83 R101
Binding residue
(residue number reindexed from 1)
D4 R5 F6 I7 C8 Y10 Y13 T19 I20 R24 R25 P27 I28 K57 M58 Y59 S60 R61 R65 R72 R74 R92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0048500 signal recognition particle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3ktv, PDBe:3ktv, PDBj:3ktv
PDBsum3ktv
PubMed20179341
UniProtP09132|SRP19_HUMAN Signal recognition particle 19 kDa protein (Gene Name=SRP19)

[Back to BioLiP]