Structure of PDB 3ko2 Chain B Binding Site BS01

Receptor Information
>3ko2 Chain B (length=161) Species: 141716 (Monomastix sp. OKE-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLQPTEAAYIAGFLDGDGSIYARLIPRPDYKDIKYQVELAISFIQRKDKF
PYLQDIYDQLGKRGTLRKDRGDGIADYTIWGSTHLSIILPDLVPYLRIKK
KQANRILHIINLYPQAQKNPSKFLDLVKIVDDVQNLNKRADELKSTNYDR
LLEEFLKAGKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ko2 Computational reprogramming of homing endonuclease specificity at multiple adjacent base pairs.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
D22 S24 Y26 R28 R32 I49 Q50 R51 R75 Q139 N142
Binding residue
(residue number reindexed from 1)
D17 S19 Y21 R23 R27 I44 Q45 R46 R70 Q134 N137
Enzymatic activity
Catalytic site (original residue number in PDB) G21 D22
Catalytic site (residue number reindexed from 1) G16 D17
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0046872 metal ion binding
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:3ko2, PDBe:3ko2, PDBj:3ko2
PDBsum3ko2
PubMed20435674
UniProtC0JWR6

[Back to BioLiP]