Structure of PDB 3kmd Chain B Binding Site BS01

Receptor Information

>3kmd Chain B (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTC
PVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPP
QHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSS
CMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRK

Ligand information

>3kmd Chain E (length=19) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gggcatgcctaggcatgcc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3kmd Crystal structure of the p53 core domain bound to a full consensus site as a self-assembled tetramer.
Resolution	2.15 Å
Binding residue (original residue number in PDB)	K120 S121 R248
Binding residue (residue number reindexed from 1)	K29 S30 R157

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006915	apoptotic process

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3kmd, PDBe:3kmd, PDBj:3kmd
PDBsum	3kmd
PubMed	20159469
UniProt	P04637\|P53_HUMAN Cellular tumor antigen p53 (Gene Name=TP53)

[Back to BioLiP]