Structure of PDB 3k0j Chain B Binding Site BS01

Receptor Information
>3k0j Chain B (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Ligand information
>3k0j Chain F (length=87) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcgacucggggugcccuccauugcacuccggaggcugagaaauacccgua
ucaccugaucuggauaaugccagcguagggaagucgc
<<<<<<<<<<..<<<.<<<..........>>>>>>.........>>>>..
...<<<...<<<<......>>>>...>>>..>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3k0j Thermodynamic analysis of ligand binding and ligand binding-induced tertiary structure formation by the thiamine pyrophosphate riboswitch.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Y313 N315 N316 E319 K328 H331 I343 R347 S348 L349 K350 M351 R352 Q354 F356 R383 K388 D390 S391 D392
Binding residue
(residue number reindexed from 1)		Y8 N10 N11 E14 K23 H26 I38 R42 S43 L44 K45 M46 R47 Q49 F51 R78 K83 D85 S86 D87
Binding affinityPDBbind-CN: Kd=8.65nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3k0j, PDBe:3k0j, PDBj:3k0j
PDBsum3k0j
PubMed19948769
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]