Structure of PDB 3jzq Chain B Binding Site BS01

Receptor Information
>3jzq Chain B (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMV
YCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLAT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jzq Structure-based design of high affinity peptides inhibiting the interaction of p53 with MDM2 and MDMX.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		K50 M53 G57 I60 Y66 Q71 H72 V92 K93 P95 Y99
Binding residue
(residue number reindexed from 1)		K26 M29 G33 I36 Y42 Q47 H48 V68 K69 P71 Y75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jzq, PDBe:3jzq, PDBj:3jzq
PDBsum3jzq
PubMed19910468
UniProtO15151|MDM4_HUMAN Protein Mdm4 (Gene Name=MDM4)

[Back to BioLiP]