Structure of PDB 3jxt Chain B Binding Site BS01

Receptor Information
>3jxt Chain B (length=95) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TREPRKIILHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELRRGD
RILSVNGVNLRNATHEQAAAALKRAGQSVTIVAQYRPEEYSRFES
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jxt Caged mono- and divalent ligands for light-assisted disruption of PDZ domain-mediated interactions.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		G413 L414 F416 N417 I418 V419 E422 S430 H463 E464 L470 F491
Binding residue
(residue number reindexed from 1)		G15 L16 F18 N19 I20 V21 E24 S32 H65 E66 L72 F93
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3jxt, PDBe:3jxt, PDBj:3jxt
PDBsum3jxt
PubMed23480637
UniProtQ62936|DLG3_RAT Disks large homolog 3 (Gene Name=Dlg3)

[Back to BioLiP]