Structure of PDB 3jvf Chain B Binding Site BS01

Receptor Information
>3jvf Chain B (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRN
LGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTC
VTPV
Ligand information
Ligand IDCA
InChIInChI=1S/Ca/q+2
InChIKeyBHPQYMZQTOCNFJ-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Ca++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0
[Ca+2]
FormulaCa
NameCALCIUM ION
ChEMBL
DrugBankDB14577
ZINC
PDB chain3jvf Chain B Residue 134 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jvf Structural basis of receptor sharing by interleukin 17 cytokines.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
N43 E45
Binding residue
(residue number reindexed from 1)
N19 E21
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005125 cytokine activity
GO:0005126 cytokine receptor binding
GO:0005515 protein binding
GO:0019955 cytokine binding
GO:0042803 protein homodimerization activity
GO:0046982 protein heterodimerization activity
Biological Process
GO:0001819 positive regulation of cytokine production
GO:0002225 positive regulation of antimicrobial peptide production
GO:0002250 adaptive immune response
GO:0006954 inflammatory response
GO:0016525 negative regulation of angiogenesis
GO:0017015 regulation of transforming growth factor beta receptor signaling pathway
GO:0032645 regulation of granulocyte macrophage colony-stimulating factor production
GO:0032663 regulation of interleukin-2 production
GO:0032675 regulation of interleukin-6 production
GO:0032677 regulation of interleukin-8 production
GO:0032755 positive regulation of interleukin-6 production
GO:0032761 positive regulation of lymphotoxin A production
GO:0045087 innate immune response
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0050829 defense response to Gram-negative bacterium
GO:0050830 defense response to Gram-positive bacterium
GO:0051216 cartilage development
GO:0097400 interleukin-17-mediated signaling pathway
GO:1900017 positive regulation of cytokine production involved in inflammatory response
GO:2000340 positive regulation of chemokine (C-X-C motif) ligand 1 production
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3jvf, PDBe:3jvf, PDBj:3jvf
PDBsum3jvf
PubMed19838198
UniProtQ96PD4|IL17F_HUMAN Interleukin-17F (Gene Name=IL17F)

[Back to BioLiP]