Structure of PDB 3j0q Chain B Binding Site BS01

Receptor Information
>3j0q Chain B (length=213) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFSGSL
KLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKL
SKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTDVRS
TIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMSVNFFVSLLKKNWQNVGS
LVVKSSMGPAFRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3j0q Structure and dynamics of the Mammalian ribosomal pretranslocation complex.
Resolution10.6 Å
Binding residue
(original residue number in PDB)		L93 N94 K95 N96 K97 K98 L99 I100 K101 K102 R122 L123 P126 Q127 L128 S129 A131
Binding residue
(residue number reindexed from 1)		L90 N91 K92 N93 K94 K95 L96 I97 K98 K99 R119 L120 P123 Q124 L125 S126 A128
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000055 ribosomal large subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j0q, PDBe:3j0q, PDBj:3j0q
PDBsum3j0q
PubMed22017870
UniProtP0CX43|RL1A_YEAST Large ribosomal subunit protein uL1A (Gene Name=RPL1A)

[Back to BioLiP]