Structure of PDB 3ins Chain B Binding Site BS01

Receptor Information

>3ins Chain B (length=30) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Ligand information

>3ins Chain A (length=21) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GIVEQCCTSICSLYQLENYCN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3ins Structure of insulin: results of joint neutron and X-ray refinement.
Resolution	1.5 Å
Binding residue (original residue number in PDB)	F1 N3 Q4 H5 L6 C7 L11 C19 R22 G23 F24 F25 Y26 P28 K29
Binding residue (residue number reindexed from 1)	F1 N3 Q4 H5 L6 C7 L11 C19 R22 G23 F24 F25 Y26 P28 K29

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:3ins, PDBe:3ins, PDBj:3ins
PDBsum	3ins
PubMed	2695122
UniProt	P01315\|INS_PIG Insulin (Gene Name=INS)

[Back to BioLiP]