Structure of PDB 3im4 Chain B Binding Site BS01

Receptor Information
>3im4 Chain B (length=49) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEEA
Ligand information
>3im4 Chain C (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DEAQEELAWKIAKMIVSDVMQQAQYDQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3im4 Structure of D-AKAP2:PKA RI Complex: Insights into AKAP Specificity and Selectivity
Resolution2.285 Å
Binding residue
(original residue number in PDB)
L13 Q26 L29 K30 I33
Binding residue
(residue number reindexed from 1)
L2 Q15 L18 K19 I22
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3im4, PDBe:3im4, PDBj:3im4
PDBsum3im4
PubMed20159461
UniProtP00514|KAP0_BOVIN cAMP-dependent protein kinase type I-alpha regulatory subunit (Gene Name=PRKAR1A)

[Back to BioLiP]