Structure of PDB 3idi Chain B Binding Site BS01

Receptor Information

>3idi Chain B (length=217) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWL
AIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHR
RGPTGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPSGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTC
NVNHKPSNTKVDKRVEP

Ligand information

>3idi Chain C (length=5) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ALDKW

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3idi Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications.
Resolution	2.1 Å
Binding residue (original residue number in PDB)	G33 D54 D56 R95 P98 V100K
Binding residue (residue number reindexed from 1)	G33 D56 D58 R100 P103 V107

External links

PDB	RCSB:3idi, PDBe:3idi, PDBj:3idi
PDBsum	3idi
PubMed	19740978

[Back to BioLiP]